Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 (SerPINB5), serpin family, is a serine protease inhibitor originally identified as a tumor suppressor in epithelial cells. Maspin reduces the motility/invasiveness of tumor cells and functions as an angiogenesis inhibitor.
특이성
Anti-SerPINB5 polyclonal antibody reacts with canine, chicken, rat, bovine, human, mouse, and rabbit Maspin/Serpin peptidase inhibitor, clade B (ovalbumin), member 5 proteins.
면역원
Synthetic peptide directed towards the middle region of human SERPINB5
애플리케이션
Anti-SerPINB5 polyclonal antibody is used to tag maspin for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of maspin in processes such as angiogenesis and tumor suppression.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper)
생화학적/생리학적 작용
As a tumor suppressor, it blocks the growth, invasion, and metastatic properties of mammary tumors. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.
서열
Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Molecular and cellular biochemistry, 422(1-2), 21-29 (2016-09-04)
Elevated concentrations of circulating non-esterified fatty acids (NEFA) were reported in (a) humans with lipodystrophy, (b) humans following bariatric surgery, and (c) transgenic mice with reduced amounts of adipose tissue. Paradoxically, these findings suggest that the reduction of adipose tissue
질문
후기
★★★★★ 평점 값 없음
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..