가격 및 재고 정보를 현재 이용할 수 없음 고객지원팀으로 연락바랍니다.
추천 제품
생물학적 소스
mouse
Quality Level
항체 형태
purified antibody
항체 생산 유형
primary antibodies
클론
HO-1-1, monoclonal
양식
liquid
포함
≤0.1% sodium azide as preservative
종 반응성
human, rat, canine, monkey, mouse, bovine
제조업체/상표
Calbiochem®
저장 조건
OK to freeze
avoid repeated freeze/thaw cycles
동형
IgG1
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
bovine ... Hmox1(513221)
dog ... Hmox1(442987)
human ... HMOX1(3162)
mouse ... Hmox1(15368)
rat ... Hmox1(24451)
rhesus monkey ... Hmox1(719266)
일반 설명
Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.
면역원
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
애플리케이션
Immunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
포장
Please refer to vial label for lot-specific concentration.
경고
Toxicity: Standard Handling (A)
물리적 형태
In PBS, 50% glycerol.
재구성
Following initial thaw, aliquot and freeze (-20°C).
기타 정보
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
법적 정보
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Hai Lu et al.
Brain sciences, 14(5) (2024-05-25)
The discovery of novel diagnostic methods and therapies for Alzheimer's disease (AD) faces significant challenges. Previous research has shed light on the neuroprotective properties of Apelin-13 in neurodegenerative disorders. However, elucidating the mechanism underlying its efficacy in combating AD-related nerve
László Potor et al.
Oxidative medicine and cellular longevity, 2018, 3812568-3812568 (2018-03-22)
The infiltration of red blood cells into atheromatous plaques is implicated in atherogenesis. Inside the lesion, hemoglobin (Hb) is oxidized to ferri- and ferrylHb which exhibit prooxidant and proinflammatory activities. Cystathione gamma-lyase- (CSE-) derived H2S has been suggested to possess
László Potor et al.
Oxidative medicine and cellular longevity, 2013, 676425-676425 (2013-06-15)
Oxidized cell-free hemoglobin (Hb), including covalently cross-linked Hb multimers, is present in advanced atherosclerotic lesions. Oxidation of Hb produces methemoglobin (Fe(3+)) and ferryl hemoglobin (Fe(4+) = O(2-)). Ferryl iron is unstable and can return to the Fe(3+) state by reacting
Steven J T Jackson et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 60, 431-438 (2013-08-14)
Curcumin, a component of turmeric spice that imparts flavor and color to curry, is thought to possess anti-inflammatory and antioxidant properties in biological tissues. However, while such efficacies have been described in the context of carcinogenesis, the impact of curcumin
Qian Sun et al.
Experimental and therapeutic medicine, 21(3), 190-190 (2021-01-26)
The nuclear erythroid 2-related factor 2 (NRF2)/antioxidant response element (ARE) pathway has been shown to provide strong protection against oxidative stress injury induced by renal ischemia-reperfusion (IR). However, the endogenous regulatory mechanism of the NRF2/ARE pathway in renal IR injury
활성 필터
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.
