219483

Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control

A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58).

• 동의어(들): Caveolin-1 Scaffolding Domain Peptide, Cell-permeable, Negative Control, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK- WGI DKASFTTFTVTKYWF RY, AP-Cav-X, Pen-C1-SD-X, RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY
• 실험식(Hill 표기법): C₂₂₈H₃₃₅N₆₁O₄₉S
• Molecular Weight: 4746.54
• UNSPSC 코드: 12352200

속성

• Quality Level: 100
• 분석: ≥95% (HPLC)
• 형태: lyophilized solid
• 제조업체/상표: Calbiochem^®
• 저장 조건: OK to freeze; desiccated (hygroscopic); protect from light
• 색상: white
• solubility: DMSO: 2 mg/mL
• 배송 상태: wet ice
• 저장 온도: −20°C

설명

일반 설명

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

A scrambled caveolin-1 scaffolding domain peptide (C1-SD_82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

생화학적/생리학적 작용

Cell permeable: no

Primary Target
Negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482).

Product does not compete with ATP.

Reversible: no

포장

Packaged under inert gas

경고

Toxicity: Standard Handling (A)

서열

H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH

물리적 형태

Supplied as a trifluoroacetate salt.

재구성

Following reconstitution, aliquot and freeze (-20°C). Stock solutions are stable for up to 3 months at -20°C.

기타 정보

Gratton, J.P., et al. 2003. Cancer Cell4, 31.
Sukumaran, S.K., et al. 2002. J. Biol. Chem.277, 50716.
Bucci, M., et al. 2000. Nat. Med.6, 1362.

법적 정보

CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany