WH0170850M1

Monoclonal Anti-KCNG3 antibody produced in mouse

clone 5H2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-KV10.1, Anti-KV6.3, Anti-potassium voltage-gated channel, subfamily G, member 3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 5H2, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso Genebanck: NM_133329
• N° accesso UniProt: Q8TAE7
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KCNG3(170850)

Descrizione

Descrizione generale

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. (provided by RefSeq)

Immunogeno

KCNG3 (NP_579875, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS

Azioni biochim/fisiol

Potassium voltage-gated channel, subfamily G, member 3 (KCNG3) has been studied to have a regulatory function. It interacts with the potassium channel Kv2.1.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): nwg
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)