Passa al contenuto
Merck
Tutte le immagini(5)

Documenti

WH0008841M2

Sigma-Aldrich

Monoclonal Anti-HDAC3 antibody produced in mouse

clone 3E11, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-HD3, Anti-RPD3, Anti-RPD32, Anti-histone deacetylase 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(5)

About This Item

Numero MDL:
MFCD02096545
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3E11, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

rat, mouse, human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

NM_003883

N° accesso UniProt

O15379

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HDAC3(8841)

Descrizione generale

Histone deacetylase 3 (HDAC3) is an epigenetic modifier and is expressed in various tissues. It belongs to the class I subfamily of histone deacetylases. The HDAC3 gene is localized on human chromosome 5q31.3.

Immunogeno

HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Raccomandato

N° Catalogo
Descrizione
Determinazione del prezzo

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

HDAC3 role in medication consumption in medication overuse headache patients: a pilot study.
Pisanu C, et al.
Human Genomics, 9, 30-30 (2015)
Histone deacetylase 3 indirectly modulates tubulin acetylation.
Bacon T, et al.
The Biochemical Journal, 472(3), 367-377 (2015)
Hdac3 Is Essential for the Maintenance of Chromatin Structure and Genome Stability.
Srividya B, et al.
Cancer Cell, 18(5), 436-447 (2010)
Rebekah Tillotson et al.
Molecular cell, 81(6), 1260-1275 (2021-02-10)
DNA methylation is implicated in neuronal biology via the protein MeCP2, the mutation of which causes Rett syndrome. MeCP2 recruits the NCOR1/2 co-repressor complexes to methylated cytosine in the CG dinucleotide, but also to sites of non-CG methylation, which are

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.