Passa al contenuto
Merck
Tutte le immagini(5)

Documenti

WH0004760M1

Sigma-Aldrich

Monoclonal Anti-NEUROD1 antibody produced in mouse

clone 3H8, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-BETA2, Anti-BHF1, Anti-NEUROD, Anti-neurogenic differentiation 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(5)

About This Item

Numero MDL:
MFCD03097085
Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

3H8, monoclonal

Forma fisica

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso Genebanck

BC009046

N° accesso UniProt

Q13562

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... NEUROD1(4760)

Descrizione generale

Neuronal differentiation 1 (NeuroD1) belongs to the family of a basic helix-loop-helix transcription factor. The NEUROD1 gene is localized on human chromosome 2q31.3 and is expressed in developing neurons.

Immunogeno

NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT

Azioni biochim/fisiol

Neuronal differentiation 1 (NeuroD1) may mediate the genesis of functional neurons from glial cells. Its higher expression favors neural differentiation in elder rats. NeuroD1 may be crucial for reversing functional impairment by favoring axonal regeneration in nerve injury. Various mutations in NEUROD1 reported have direct implications in the pathophysiology of early-onset diabetes, retinal dystrophy, nonsyndromic retinitis pigmentosa, and neurological abnormalities.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Lack of association between NeuroD1/D6 gene polymorphism and heroin dependence in Han-chinese male population
Tsou CC, et al.
Journal of Medical Sciences null
Muhua Lai et al.
Experimental neurology, 327, 113215-113215 (2020-01-29)
Neurogenic differentiation 1 (NeuroD1) is mainlyexpressed in developing neurons where it plays critical roles in neuronal maturation and neurite elongation. The potential role and mechanism of NeuroD1 in adult axonal regeneration is not clear. The present study used synapsin (SYN)
Feng Wang et al.
Investigative ophthalmology & visual science, 56(1), 150-155 (2014-12-06)
Mutations in the same gene can lead to different clinical phenotypes. In this study, we aim to identify novel genotype-phenotype correlations and novel disease genes by analyzing an unsolved autosomal recessive retinitis pigmentosa (ARRP) Han Chinese family. Whole exome sequencing
Abhijeet Pataskar et al.
The EMBO journal, 35(1), 24-45 (2015-11-01)
Cell fate specification relies on the action of critical transcription factors that become available at distinct stages of embryonic development. One such factor is NeuroD1, which is essential for eliciting the neuronal development program and possesses the ability to reprogram

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.