Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

WH0003043M1

Sigma-Aldrich

Monoclonal Anti-HBB antibody produced in mouse

clone 2H3, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

Anti-CD113tC, Anti-HBD, Anti-hemoglobin, Anti-hemoglobin, beta

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μG
489,00 €

489,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μG
489,00 €

About This Item

Numero MDL:
Codice UNSPSC:
12352203
NACRES:
NA.41

489,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

2H3, monoclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

ELISA: suitable
capture ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG3κ

N° accesso Genebanck

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... HBB(3043)

Descrizione generale

HBB (hemoglobin subunit β) codes for a β-globin that consists of three exons. This gene is located on human chromosome 11p15. HBB is a serum protein that belongs to the histone-like protein family.
The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5′-epsilon -- gamma-G -- gamma-A -- delta -- beta--3′. (provided by RefSeq)

Immunogeno

HBB (AAH07075, 38 a.a. ~ 147 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALPHKYH

Azioni biochim/fisiol

HBB (hemoglobin subunit β) participates in oxygen transport from the lung to various peripheral tissues. Mutation in HBB result in Sickle cell disease (SCD). Overexpression of HBB has been observed in patients with periodontal disease.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Proteomic analysis of saliva identifies potential biomarkers for orthodontic tooth movement
Ellias MF, et al.
TheScientificWorldJournal (2012)
Two novel C-terminal frameshift mutations in the ?-globin gene lead to rapid mRNA decay
Rawa K, et al.
BMC Medical Genetics, 18(1), 65-65 (2017)
Loss of heterozygosity for chromosome 11 in primary human breast tumors is associated with poor survival after metastasis
Winqvist R, et al.
Cancer Research, 55(12), 2660-2664 (1995)
A phylogenetic analysis of Borrelia burgdorferi sensu lato based on sequence information from the hbb gene, coding for a histone-like protein
Valsangiacomo C, et al.
International Journal of Systematic Bacteriology, 47(1), 1-10 (1997)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.