WH0002597M1

Monoclonal Anti-GAPDH antibody produced in mouse

clone 3C2, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: Anti-G3PD, Anti-GAPD, Anti-MGC88685, Anti-glyceraldehyde-3-phosphate dehydrogenase
• Numero MDL: MFCD01322099
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 3C2, monoclonal
• Forma fisica: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• N° accesso Genebanck: NM_002046
• N° accesso UniProt: P04406
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GAPDH(2597)

Descrizione

Descrizione generale

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), a classic glycolytic enzyme, is a multi-functional protein. It is mainly present in the cytoplasm. GAPDH is ubiquitously expressed. The GAPDH gene is located on human chromosome 12.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. (provided by RefSeq)

Immunogeno

GAPDH (NP_002037, 226 a.a. ~ 335 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Applicazioni

Monoclonal Anti-GAPDH antibody produced in mouse has been used in western blot, (1:5000), and (1:2,000).

Azioni biochim/fisiol

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) participates in energy metabolism. It might have extra glycolytic roles in DNA repair. GAPDH plays a key role in glycolysis and several non-glycolytic actions. GAPDH binds to microtubules and regulates microtubule bundling and aids in membrane fusion. GAPDH participates in gene transcription, DNA replication, and nuclear RNA export. GAPDH acts as a uracil DNA glycosylase (UDG) that plays a role in DNA repair. It also acts as a mediator for cell death. GAPDH may play a role in Alzheimer′s disease (AD). It can be a potential therapeutic target in chemotherapy. Overexpression of the GAPDH gene in the T cell lineage is associated with angioimmunoblastic T cell lymphoma.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Note legali

GenBank is a registered trademark of United States Department of Health and Human Services

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable
• Dispositivi di protezione individuale: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)