SAB5702377

Anti-Laminin beta 1 Antibody, clone 6I9T4, Rabbit Monoclonal

• Sinonimo/i: CLM, LIS5
• Codice UNSPSC: 12352203
• NACRES: NA.46

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Materiali: colorless
• Clone: 6I9T4, monoclonal
• Forma fisica: liquid
• PM: 250 kDa
• Reattività contro le specie: rat, human, rat
• Concentrazione: 1 mg/mL
• tecniche: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• Colore: colorless
• Isotipo: IgG
• Sequenza immunogenica: KKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQELARLEGEVRSLLKDISQKVAVYSTCL
• N° accesso UniProt: P07942
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... LAMB1(3912)

Descrizione

Descrizione generale

Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis.

Immunogeno

A synthetic peptide corresponding to a sequence within amino acids 1687-1786 of human Laminin beta 1 (P07942).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Applicazioni

WB, IF/ICC

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1