SAB2108004
Anti-BDNF antibody produced in rabbit
Sinonimo/i:
Anti-ANON2, Anti-BULN2
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
27kDa
Reattività contro le specie
horse, rat, rabbit, dog, mouse, human, pig
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunoblotting: suitable
immunohistochemistry: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... BDNF(627)
Descrizione generale
The brain derived neurotrophic factor (BDNF) gene is mapped to human chromosome 11p14.1. BDNF is a member of the neurotrophin family of growth factors. The gene encodes a precursor protein, proBDNF. Mature BDNF (mBDNF) is synthesized by post-translational cleavage of proBDNF. Both proBDNF and mBDNF play crucial roles in cellular signaling.
Immunogeno
Synthetic peptide directed towards the middle region of human BDNF
Applicazioni
Anti-BDNF antibody produced in rabbit has been used in immunohistochemistry and western blotting.
Azioni biochim/fisiol
Brain derived neurotrophic factor (BDNF) is involved in hippocampal function and verbal episodic memory in humans. Hence, variation in the BDNF gene expression alters these neurological functions. BDNF also plays a vital role in vascular function and participates in angiogenesis via the specific receptor tropomyosin-related kinase B (TrkB). It is involved in the pathogenesis of Alzheimer′s disease. ProBDNF interacts with p75 neurotrophin receptor, leading to long-term depression in the hippocampus.
Sequenza
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
I clienti hanno visto anche
Expression of nerve growth factor and brain-derived neurotrophic factor in astrocytomas.
Liu TT, et al.
Oncology Letters, 15, 533-537 (2018)
Running wheel exercise reduces a-synuclein aggregation and improves motor and cognitive function in a transgenic mouse model of Parkinson's disease
Zhou W, et al.
PLoS ONE, 12 (2017)
Kíssila Rabelo et al.
Frontiers in immunology, 11, 2146-2146 (2020-09-29)
In Brazil, an epidemic of Zika virus (ZIKV) infections was declared in 2015 that coincided with alarming reports of microcephaly in newborns associated with mother infection. Although the virus has placental tropism, changes in the tissue morphology and immunity of
Daniela Rodrigues-Amorim et al.
Frontiers in psychiatry, 10, 885-885 (2019-12-19)
Schizophrenia is a severe and disabling psychiatric disorder with a complex and multifactorial etiology. The lack of consensus regarding the multifaceted dysfunction of this ailment has increased the need to explore new research lines. This research makes use of proteomics
Ting-Ting Liu et al.
Oncology letters, 15(1), 533-537 (2018-02-03)
Neurotrophic factors (NTFs) are well known to serve critical functions in neural survival, neurite growth and cell differentiation in vivo and in vitro. Previous progress has indicated that nerve growth factor (NGF) and brain-derived neurotrophic factor (BDNF), two NTF family
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.