SAB2106426

Anti-IGHMBP2 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CATF1, Anti-CMT2S, Anti-HCSA, Anti-HMN6, Anti-SMARD1, Anti-SMUBP2, Anti-ZFAND7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 109 kDa
• Reattività contro le specie: bovine, mouse, guinea pig, human, dog, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NM_009212
• N° accesso UniProt: P40694
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... IGHMBP2(3508) ; mouse ... Ighmbp2(20589)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal of human IGHMBP2

Azioni biochim/fisiol

Ighmbp2 is a 5′ to 3′ helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5′-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5′-GGGCT-3′ motif. Ighmbp2 interacts with tRNA-Tyr.

Sequenza

Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable