SAB2102013

Anti-RNASEH1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-H1RNA, Anti-Ribonuclease H1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 32 kDa
• Reattività contro le specie: horse, dog, rabbit, pig, human, bovine, mouse, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso UniProt: O60930
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RNASEH1(246243)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human RNASEH1

Azioni biochim/fisiol

RNASEH1 belongs to the RNase H family. It contains 1 RNase H domain. RNASEH1 is an endonuclease that specifically degrades the RNA of RNA-DNA hybrids.

Sequenza

Synthetic peptide located within the following region: EVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable