SAB1403506

Monoclonal Anti-MAP3K15 antibody produced in mouse

clone 1H7, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: FLJ16518, bA723P2.3
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1H7, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~36.67 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• N° accesso NCBI: NM_001001671
• N° accesso UniProt: Q6ZN16
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MAP3K15(389840)

Descrizione

Descrizione generale

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) belongs to the group of apoptosis signal-regulating kinases. It is expressed in the kidney and the gene encoding it is localized on human chromosome Xp22.12.

Immunogeno

MAP3K15 (NP_001001671, 691 a.a. ~ 786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD

Azioni biochim/fisiol

Mitogen-activated protein kinase kinase kinase 15 (MAP3K15) modulates blood pressure in the kidney. It has a role in signal transduction cascades related to apoptotic cell death initiated due to cellular stress. ASK3 has been shown to protect HeLa cells against cytotoxicity induced by oxidative stress, antibodies or proteins.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable