SAB1403361

Monoclonal Anti-LENG4 antibody produced in mouse

clone 1D4, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: BB1, LENG4, LPIAT, hMBOA-7
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1D4, monoclonal
• Stato: buffered aqueous solution
• PM: antigen ~36.78 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2aκ
• N° accesso NCBI: NM_024298
• N° accesso UniProt: Q96N66
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MBOAT7(79143)

Descrizione

Descrizione generale

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 belongs to membrane-bound O-acyltransferase family. The gene encoding it is localized on human chromosome 19q13.42.

Mouse monoclonal antibody raised against a partial recombinant LENG4.

Immunogeno

LENG4 (NP_077274.2, 96 a.a. ~ 192 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TPTPFTNAVQLLLTLKLVSLASEVQDLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQPFPGAVPSLRPLL

Azioni biochim/fisiol

Membrane bound O-acyltransferase domain containing 7 (MBOAT7) or LENG4 is an integral membrane protein important for reacylation of phospholipids. LENG4 is highly specific for arachidonoyl-coenzyme A and is involved in arachidonate recycling. It interacts with the small subunit of serine palmitoyltransferase a (ssSPTa). This interaction is important for LENG4-dependent incorporation of arachidonic acid into phosphatidylinositol.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable