Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

SAB1403063

Sigma-Aldrich

Monoclonal Anti-KLF2 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

Sinonimo/i:

LKLF

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(2)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

mouse

Coniugato

unconjugated

Forma dell’anticorpo

purified immunoglobulin

Tipo di anticorpo

primary antibodies

Clone

1D1, monoclonal

Forma fisica

buffered aqueous solution

PM

antigen ~35.79 kDa

Reattività contro le specie

human

tecniche

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotipo

IgG2aκ

N° accesso NCBI

NM_016270

N° accesso UniProt

Q9Y5W3

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... KLF2(10365)

Categorie correlate

Descrizione generale

Kruppel like factor 2 (KLF2) is a tumor-suppressor gene, localized on human chromosome 19p13.11.

Immunogeno

KLF2 (NP_057354, 263 a.a. ~ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH

Azioni biochim/fisiol

Kruppel like factor 2 (KLF2) is crucial for lung functioning, cell differentiation, migration and tissue development. It modulates endothelial pro-inflammatory activation. The protein has roles in cardiovascular development and T-cell differentiation. Mutation in the gene encoding it has been associated with heritable pulmonary arterial hypertension.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

A study of the relationships between KLF2polymorphisms and body weight control in a French population
Aline Meirhaeghe
BMC Medical Genetics (2006)
W P Ries et al.
Annals of the Royal College of Surgeons of England, 101(8), 609-616 (2019-09-12)
Hypothermic machine perfusion, an organ preservation modality, involves flow of chilled preservation fluid through an allograft's vasculature. This study describes a simple, reproducible, human model that allows for interrogation of flow effects during ex vivo organ perfusion. Gonadal veins from
First identification of Kruppel-like factor 2 mutation in heritable pulmonary arterial hypertension.
Eichstaedt CA
Clinical Science (2017)
Rafal Bartoszewski et al.
European journal of cell biology, 96(8), 758-766 (2017-10-19)
The role of microRNAs in controlling angiogenesis is recognized as a promising therapeutic target in both cancer and cardiovascular disorders. However, understanding a miRNA's pleiotropic effects on angiogenesis is a limiting factor for these types of therapeutic approaches. Using genome-wide
Kruppel-like factor 2 suppresses growth and invasion of gastric cancer cells in vitro and in vivo.
Mao QQ
Journal of Biological Regulators and Homeostatic Agents (2016)

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.