SAB1403026

Monoclonal Anti-NAPSA, (C-terminal) antibody produced in mouse

clone 2B1, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: KAP, Kdap, NAP1, NAPA, SNAPA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 2B1, monoclonal
• Forma fisica: buffered aqueous solution
• PM: antigen ~69.56 kDa
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; indirect ELISA: suitable
• Isotipo: IgG2bκ
• N° accesso NCBI: BC017842
• N° accesso UniProt: O96009
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NAPSA(9476)

Descrizione

Descrizione generale

The activation peptides of aspartic proteinases plays role as inhibitors of the active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The pronapsin A gene is expressed predominantly in lung and kidney. Its translation product is predicted to be a fully functional, glycosylated aspartic proteinase precursor containing an RGD motif and an additional 18 residues at its C-terminus. (provided by RefSeq)

Immunogeno

NAPSA (AAH17842, 26 a.a. ~ 420 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable