SAB1401866

Monoclonal Anti-ISCA1 antibody produced in mouse

clone 1A11, purified immunoglobulin, buffered aqueous solution

• Sinonimo/i: HBLD2, ISA1, MGC4276, RP11-507D14.2, hIscA
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: purified immunoglobulin
• Tipo di anticorpo: primary antibodies
• Clone: 1A11, monoclonal
• Stato: buffered aqueous solution
• Reattività contro le specie: human
• tecniche: capture ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aλ
• N° accesso NCBI: BC002675
• N° accesso UniProt: Q9BUE6
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ISCA1(81689)

Descrizione

Descrizione generale

ISCA1 is a mitochondrial protein involved in the biogenesis and assembly of iron-sulfur clusters, which play a role in electron-transfer reactions (Cozar-Castellano et al., 2004 [PubMed 15262227]).[supplied by OMIM

Immunogeno

ISCA1 (AAH02675, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI

Azioni biochim/fisiol

ISCA1 (iron-sulfur cluster assembly 1) is an A-type protein that maintains the assembly of a subset of Fe/S apoproteins. Depletion of the protein leads to structural alterations in mitochondria involving organelle enlargement and a loss of cristae membranes. ISCA1 is considered as an iron binding protein. It might serve as an iron chaperone and be involved in the formation of iron clusters.

Caratteristiche e vantaggi

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 12 - Non Combustible Liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable