Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

SAB1400208

Sigma-Aldrich

Anti-SLC25A3 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

Sinonimo/i:

Anti-OK/SW-cl.48, Anti-PHC

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

50 μG
416,00 €

416,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
50 μG
416,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

416,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

mouse

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

Reattività contro le specie

human

tecniche

immunofluorescence: suitable
western blot: 1 μg/mL

N° accesso UniProt

Condizioni di spedizione

dry ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... SLC25A3(5250)

Descrizione generale

Solute carrier family 25 member 3 (SLC25A3) gene codes for mitochondrial phosphate carrier (PiC) protein.[1] SLC25A3/ PiC protein belongs to the mitochondrial-carrier family. PiC consists of six transmembrane segments, 3-fold symmetry, and an N and C termini.[1] The SLC25A3 gene is located on human chromosome 12q23.1.

Immunogeno

SLC25A3 (NP_002626.1, 1 a.a. ~ 361 a.a) full-length human protein.

Sequence
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ

Applicazioni

Anti-SLC25A3 antibody produced in mouse has been used in immunoblotting.[1]

Azioni biochim/fisiol

Solute carrier family 25 member 3 (SLC25A3) helps in the transportation of inorganic phosphate into the mitochondrial matrix. Heterozygous mutations in the SLC25A3 gene might be related in vivo with respiratory distress and hypertrophic cardiomyopathy.[1] Assays in Lactococcus lactis confirm the role of SLC25A3 as a copper transporter.

Stato fisico

Solution in phosphate buffered saline, pH 7.4

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Erin L Seifert et al.
The Journal of biological chemistry, 291(50), 26126-26137 (2016-10-27)
The relevance of mitochondrial phosphate carrier (PiC), encoded by SLC25A3, in bioenergetics is well accepted. However, little is known about the mechanisms mediating the cellular impairments induced by pathological SLC25A3 variants. To this end, we investigated the pathogenicity of a
Aren Boulet et al.
The Journal of biological chemistry, 293(6), 1887-1896 (2017-12-15)
Copper is required for the activity of cytochrome c oxidase (COX), the terminal electron-accepting complex of the mitochondrial respiratory chain. The likely source of copper used for COX biogenesis is a labile pool found in the mitochondrial matrix. In mammals
Johannes A Mayr et al.
American journal of human genetics, 80(3), 478-484 (2007-02-03)
The mitochondrial phosphate carrier SLC25A3 transports inorganic phosphate into the mitochondrial matrix, which is essential for the aerobic synthesis of adenosine triphosphate (ATP). We identified a homozygous mutation--c.215G-->A (p.Gly72Glu)--in the alternatively spliced exon 3A of this enzyme in two siblings

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.