Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

HPA042199

Sigma-Aldrich

Anti-GPSM1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-AGS3, Anti-DKFZP727I051, Anti-G-Protein Signaling Modulator 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
541,00 €

541,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
541,00 €

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

541,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

Sequenza immunogenica

SPAASEKPDLAGYEAQGARPKRTQRLSAETWDLLRLPLEREQNGDSHHSGDWRGPSRDSLPLPVRSRK

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... GPSM1(26086)

Descrizione generale

G-protein-signaling modulator 1 (GPSM1) is also called activator of G protein signalling 3 (AGS3). The GPSM1 gene is mapped to human chromosome 9q34.3. AGS3 has a N-terminal domain with seven tetratri-copeptides (TPR) repeats and the C-terminal domain with four G-protein regulatory motifs (GPR) or GoLocomotifs. Brain and testes express AGS3 in high levels.

Immunogeno

G-protein signaling modulator 1 recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

G-protein-signaling modulator 1 (GPSM1) or activator of G protein signalling 3 (AGS3) functions to regulate G protein signalling. AGS3 functions to orient mitotic spindle and modulates development of cerebral cortical progenitor cells during neurogenesis. The GPR motif of AGS3 cytokine may regulate cytokine production in airway inflammation. It also regulates autophagic pathway and protein trafficking. AGS3 is down regulated human esophageal squamous cell carcinoma. AGS3 is also less expressed in multiple myeloma. Abnormal expression of AGS3 in renal epithelium is implicated in polycystic kidney disease (PKD).(10) Defects in AGS3 gene locus is implicated in MORM syndrome (mental retardation, truncal obesity, retinal dystrophy and micropenis).

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST82026

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

G protein betagamma subunits and AGS3 control spindle orientation and asymmetric cell fate of cerebral cortical progenitors
Sanada K and Tsai L
Cell, 122(1), 119-131 (2005)
AGS proteins, GPR motifs and the signals processed by heterotrimeric G proteins
Lanier SM
Biology of the Cell, 96(5), 369-372 (2004)
A role for activator of G-protein signaling 3 (AGS3) in multiple myeloma
Shao S, et al.
International Journal of Hematology, 99(1), 57-68 (2014)
Identification of a truncated form of the G-protein regulator AGS3 in heart that lacks the tetratricopeptide repeat domains
Pizzinat N, et al.
The Journal of Biological Chemistry, 276(20), 16601-16610 (2001)
MORM syndrome (mental retardation, truncal obesity, retinal dystrophy and micropenis), a new autosomal recessive disorder, links to 9q34
Hampshire D, et al.
European Journal of Human Genetics, 14(5), 543-543 (2006)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.