HPA035526

Anti-FYCO1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-FLJ13335, Anti-FYVE and coiled-coil domain containing 1, Anti-ZFYVE7
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA035526

Proprietà

• Origine biologica: rabbit
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• tecniche: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• Sequenza immunogenica: IQEYYNKLCQEVTNRERNDQKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFS
• N° accesso UniProt: Q9BQS8
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FYCO1(79443)

Descrizione

Descrizione generale

FYVE and coiled-coil domain containing 1 (FYCO1) codes for a protein with 1478 amino acids. It has 18 exons and is of 79 kb in length. FYCO1 has a long central coiled-coil region flanked at the N terminus by an α-helical RUN domain or a zinc finger domain and at the C terminus by a FYVE domain. It is abundantly expressed in heart and skeletal muscle, skin, adipose tissue and the ovary. FYCO1 is a member of the emerging group of autophagic adaptor proteins. FYCO1 is located on human chromosome 3p21.31.

Immunogeno

FYVE and coiled-coil domain containing 1 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FYCO1 antibody has been used in immunostaining.

Azioni biochim/fisiol

FYVE and coiled-coil domain containing 1 (FYCO1) helps in the movement of autophagosomes along microtubules through its association with LC3. Mutations in FYCO1 results in autosomal-recessive congenital cataracts. FYCO1 participates in the progression of lens and transparency in humans.

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST79454

Stato fisico

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable