Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

HPA030751

Sigma-Aldrich

Anti-OGT antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

Sinonimo/i:

Anti-FLJ23071, Anti-HRNT1, Anti-MGC22921, Anti-O-GLCNAC, Anti-O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
252,50 €

252,50 €

Prezzo di listino505,00 €Risparmia il 50%

Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
252,50 €

About This Item

Numero MDL:
Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

252,50 €

Prezzo di listino505,00 €Risparmia il 50%

Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human, mouse, rat

Convalida avanzata

independent
Learn more about Antibody Enhanced Validation

tecniche

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Sequenza immunogenica

LYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWA

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... OGT(8473)

Descrizione generale

OGT (O-linked N-acetylglucosamine transferase) gene is mapped to human chromosome Xq13.1. This gene encodes for nucleo cytosolic and mitochondrial isoforms of the enzyme. OGT is highly conserved among Caenorhabditis elegans, rat, and human genomes, sharing over 65% amino acid identity. The gene includes multiple tandem tetratricopeptide repeat sequences and is modified by O-GlcNA (O-linked N-acetylglucosamine), also by tyrosine phosphorylation.

Immunogeno

O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) recombinant protein epitope signature tag (PrEST)

Applicazioni

All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-OGT antibody produced in rabbit has been used in western blotting.[1]
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Azioni biochim/fisiol

O-GlcNAc (O-linked N-acetylglucosamine) transferase (OGT) catalyzes O-GlcNAcylation that occurs in mitochondria, nuclear, and cytoplasmic proteins. O-GlcNAc transferase is a subunit of nonspecific lethal complex, a transcriptional regulator. O-GlcNAcylation involves the addition of O-GlcNAc to specific serine or threonine residue on many of the cytosolic and nuclear proteins. Disturbance in O-GlcNAcylation is associated with the development of diseases including cancer, diabetes, and Alzheimer disease. OGT is associated with increased mitochondrial respiration and elevated glycolysis. Inhibition in addition or removal of O-GlcNAc leads to a defect in preinitiation complex assembly.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78284

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

The O-GlcNAc transferase gene resides on the X chromosome and is essential for embryonic stem cell viability and mouse ontogeny.
Shafi R
Proceedings of the National Academy of Sciences of the USA, 97(11), 5735-5739 (2000)
Human RNA Polymerase II Promoter Recruitment in Vitro Is Regulated by O-Linked N-Acetylglucosaminyltransferase (OGT).
Lewis BA
The Journal of Biological Chemistry, 291(27), 14056-14061 (2016)
Suppression of OGT by microRNA24 reduces FOXA1 stability and prevents breast cancer cells invasion.
Liu Y
Biochemical and Biophysical Research Communications, 487(3), 755-762 (2017)
O-Linked N-acetylglucosamine transferase 1 regulates global histone H4 acetylation via stabilization of the nonspecific lethal protein NSL3.
Wu D
The Journal of Biological Chemistry, 292(24), 10014-10025 (2017)
Mitochondrial O-GlcNAc Transferase (mOGT) Regulates Mitochondrial Structure, Function, and Survival in HeLa Cells.
Sacoman JL
The Journal of Biological Chemistry, 292(11), 4499-4518 (2017)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.