Passa al contenuto
Merck
Tutte le immagini(5)

Documenti fondamentali

HPA023882

Sigma-Aldrich

Anti-FAT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Cadherin-related tumor suppressor homolog, Anti-Protein fat homolog, Anti-Protocadherin Fat 1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
505,00 €

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
505,00 €

About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.43

505,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Stato

buffered aqueous glycerol solution

Reattività contro le specie

human

tecniche

immunohistochemistry: 1:50- 1:200

Sequenza immunogenica

NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FAT1(2195)

Descrizione generale

FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.

Immunogeno

Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FAT1 antibody produced in rabbit has been used for western blotting. FAT1 antibody produced in rabbit has been used in immunofluorescence, tissue microarrays (TMAs) and immunohistochemistry (IHC).[1]
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Azioni biochim/fisiol

FAT atypical cadherin 1 (FAT1) acts as a proximal element of cell migration signaling pathways.FAT1 interacts with Ena/Vasodilator-stimulated phosphoprotein (VASP) at the leading edges of lamellipodia, filopodia, and microspike tips and helps in normal actin dynamics and cell polarization. FAT1, with or without β-catenin, might function as a novel biomarker for breast cancer. Mutation of FAT1 gene leads to T-cell acute lymphoblastic leukemia (T-ALL) in adults. In humans, FAT1 might act both as an oncogene and a tumor suppressor. The protein modulates oncogenic pathways in glioma cell lines. FAT1 also act as a co-activator of hypoxia and growth receptor signaling to critical tumorigenic pathways in hepatocellular carcinoma (HCC).

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85143

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Loss of FAT1 during the progression from DCIS to IDC and predict poor clinical outcome in breast cancer.
26721716
Wang L
Experimental and Molecular Pathology, 100(1), 177-183 (2016)
Podocyte proteins in congenital and minimal change nephrotic syndrome.
Suvanto M, et al.
Clinical and Experimental Nephrology, 19(3), 481-488 (2015)
FAT1 expression and mutations in adult acute lymphoblastic leukemia.
Neumann M
Blood Cancer Journal, 4 (2014)
Michael P Weekes et al.
Cell, 157(6), 1460-1472 (2014-06-07)
A systematic quantitative analysis of temporal changes in host and viral proteins throughout the course of a productive infection could provide dynamic insights into virus-host interaction. We developed a proteomic technique called "quantitative temporal viromics" (QTV), which employs multiplexed tandem-mass-tag-based
Protocadherin FAT1 binds Ena/VASP proteins and is necessary for actin dynamics and cell polarization.
Moeller MJ
The Embo Journal, 23(19), 3769-3779 (2004)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.