HPA021799

Anti-GOLGA2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinonimo/i: Anti-Cis-Golgi matrix protein GM130, Anti-Gm130 autoantigen, Anti-Golgin subfamily A member 2, Anti-Golgin-95
• Codice UNSPSC: 12352203
• Numero Human Protein Atlas: HPA021799
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Nome Commerciale: Prestige Antibodies^® Powered by Atlas Antibodies
• Stato: buffered aqueous glycerol solution
• Reattività contro le specie: human
• Convalida avanzata: RNAi knockdown; orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• tecniche: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Sequenza immunogenica: DTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLK
• N° accesso UniProt: Q08379
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... GOLGA2(2801)

Descrizione

Descrizione generale

GOLGA2 (golgin subfamily A member 2) is a peripheral Golgi-matrix protein belonging to the coiled-coil golgin family. It is mapped to human chromosome 9q34.11. It can shuffle between cis-Golgi compartments and the ER (endoplasmic reticulum)-to-Golgi carriers.

Immunogeno

Golgin subfamily A member 2 recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-GOLGA2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

GOLGA2 (Golgin subfamily A member 2) is highly involved in the maintenance of Golgi structure. The proper maintenance of Golgi structure requires specific lateral cisternal-fusion events. During mitosis, GOLGA2 helps to reorganize Golgi ribbons at a stable structure by proper distribution of enzymes in the Golgi bodies. It also participates in endoplasmic reticulum-to-Golgi transport and mitotic Golgi apparatus fragmentation. It interacts with and stabilizes GRASP65 (Golgi peripheral membrane protein p65).

Caratteristiche e vantaggi

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST75374

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable