Passa al contenuto
Merck
Tutte le immagini(3)

Documenti

HPA010856

Sigma-Aldrich

Anti-FXYD3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinonimo/i:

Anti-Chloride conductance inducer protein Mat-8 antibody produced in rabbit, Anti-FXYD domain-containing ion transport regulator 3 precursor antibody produced in rabbit, Anti-Mammary tumor 8 kDa protein antibody produced in rabbit, Anti-Phospholemman-like antibody produced in rabbit

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
Numero Human Protein Atlas:
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Nome Commerciale

Prestige Antibodies® Powered by Atlas Antibodies

Forma fisica

buffered aqueous glycerol solution

Reattività contro le specie

human

Convalida avanzata

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

tecniche

immunohistochemistry: 1:20- 1:50

Sequenza immunogenica

MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FXYD3(5349)

Descrizione generale

FXYD3 (FXYD domain containing ion transport regulator 3) belongs to the family of FXYD proteins, which form the conserved functional subunit of Na/K-ATPase. FXYD proteins are small, transmembrane proteins which span the membrane only once. They contain their characteristic FXYD (Phe-X-Tyr-Asp) motif as well as three conserved amino acid residues. This family consists of seven members which interact with Na/K-ATPase in a tissue-specific pattern. FXYD3 has two transmembrane domains instead of one, and also has its signal peptide intact. It is normally expressed in uterus, colon, skin and stomach. This protein has two isoforms- FXYD3a and FXYD3b, where FXYD3b has 26 more amino acids in its cytoplasmic region as compared to FXYD3a. This gene maps to human chromosome 19q13.12.

Immunogeno

FXYD domain-containing ion transport regulator 3 precursor recombinant protein epitope signature tag (PrEST)

Applicazioni

Anti-FXYD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Azioni biochim/fisiol

FXYD3 (FXYD domain containing ion transport regulator 3) regulates the transport of ions by interacting with and regulating the function of Na/K-ATPase. It either acts as a chloride channel or as a regulator of chloride channel. This protein is differentially expressed in many tumors, where it is overexpressed in prostate and pancreatic cancer, and down-regulated in colon and kidney cancer. Also, it is overexpressed in gastric adenocarcinoma, where it may be involved in tumorigenesis and metastasis. It is up-regulated in glioma, especially in cases of multiple gliomas and female patients. Therefore, it might play a role in glioma development. Down-regulation of FXYD3 might play a role in epithelial-mesenchymal transition, as in the case of lung cancer. It might act as a tumor suppressor, and its inactivation might result in the atypical morphology of cancer cells, as well as the progression of lung cancer.

Caratteristiche e vantaggi

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71685

Stato fisico

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Note legali

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

FXYD3 facilitates Na+ and liquid absorption across human airway epithelia by increasing the transport capacity of the Na/K ATPase.
Cano Portillo, et al.
American Journal of Physiology. Cell Physiology, 323, C1044-C1051 (2022)
Zhi-Zhou Shi et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 19(21), 5867-5878 (2013-09-07)
Our aim was to identify frequent genomic aberrations in both esophageal squamous cell carcinoma (ESCC) and esophageal dysplasia and to discover important copy number-driving genes and microRNAs (miRNA) in ESCC. We conducted array-based comparative genomic hybridization (array CGH) on 59
Hiroto Yamamoto et al.
Biological & pharmaceutical bulletin, 32(7), 1148-1154 (2009-07-03)
FXYD3, also known as Mat-8 (Mammary tumor 8 kDa), is one of mRNAs highly expressed in mouse and human breast cancers. Here, we newly found that FXYD3 protein was also overexpressed in human breast cancer specimens; invasive ductal carcinomas and
Ming-Wei Wang et al.
Oncology research, 18(4), 133-139 (2010-02-02)
FXYD3, interacting with Na+/K+-ATPase, is considered a cell surface regulator modulating the function of ion pumps and ion channels. The FXYD3 gene was originally cloned from murine mammary tumors and then from human breast tumors. However, no study of FXYD3
Koji Okudela et al.
The American journal of pathology, 175(6), 2646-2656 (2009-11-07)
FXYD3 is a FXYD-containing Na,K-ATPase ion channel regulator first identified as a protein overexpressed in murine breast tumors initiated by oncogenic ras or neu. However, our preliminary study revealed that FXYD3 expression was down-regulated in oncogenic KRAS-transduced airway epithelial cells.

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.