Passa al contenuto
Merck
Tutte le immagini(1)

Key Documents

C8490

SAFC

CRG-2 from mouse

BioReagent, recombinant, expressed in E. coli, ≥97% (SDS-PAGE), lyophilized powder, suitable for cell culture

Sinonimo/i:

CXCL10, Cytokine Responsive Gene 2, IP-10

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Numero MDL:
Codice UNSPSC:
12352209
NACRES:
NA.75

Ricombinante

expressed in E. coli

Livello qualitativo

Nome Commerciale

BioReagent

Saggio

≥97% (SDS-PAGE)

Forma fisica

lyophilized powder

PM

predicted mol wt ~8.8 kDa

tecniche

cell culture | mammalian: suitable

Impurezze

endotoxin, tested

N° accesso UniProt

Temperatura di conservazione

−20°C

Informazioni sul gene

mouse ... Cxcl10(15945)

Descrizione generale

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E. coli-expressed mature CRG-2 contains 78 amino acid residues and has a predicted molecular mass of approximately 8.8 kDa.

Recombinant Mouse CRG-2 (IP-10, CXCL10) is a member of the chemokine ??subfamily that lacks the ELR domain. Mouse CRG-2 cDNA encodes a 98 amino acid residue precursor protein with a 21 amino acid residue signal peptide that is cleaved to form the 77 amino acid residue secreted mature protein. Mature mouse CRG-2 shares approximately 67% amino acid sequence identity with human IP-10.

Stato fisico

Lyophilized from a 0.2 μm filtered solution in PBS, pH 7.4, containing 50 μg bovine serum albumin per 1 μg of cytokine

Risultati analitici

The biological activity is measured by its ability to chemoattract human lymphocytes cultured in the presence of IL-2 for 21 days, or mouse BaF/3 cells transfected with hCXCR-3.

Codice della classe di stoccaggio

11 - Combustible Solids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Dispositivi di protezione individuale

Eyeshields, Gloves, type N95 (US)


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

S Mahalingam et al.
Immunology and cell biology, 78(2), 156-160 (2000-04-13)
MuMig (monokine induced by gamma interferon) and Crg-2 (cytokine responsive gene) are chemokines of the CXC subfamily. They share activity as T and NK cell chemoattractants. Crg-2 has been shown to be inducible by IFN, TNF, IL-1 and LPS, whereas
Yingping Hou et al.
The Journal of investigative dermatology, 135(12), 3060-3067 (2015-07-24)
Recessive dystrophic epidermolysis bullosa (RDEB) is an inherited disorder characterized by skin fragility, blistering, and multiple skin wounds with no currently approved or consistently effective treatment. It is due to mutations in the gene encoding type VII collagen (C7). Using
Y Ohmori et al.
Biochemical and biophysical research communications, 168(3), 1261-1267 (1990-05-16)
Recently, we have isolated and characterized a set of cDNA clones which encode lipopolysaccharide-inducible proteins in murine peritoneal macrophages. Here, we report the sequence and identification of one of these cDNAs previously termed C7. Nucleotide sequence analysis revealed an open
P Vanguri et al.
The Journal of biological chemistry, 265(25), 15049-15057 (1990-09-05)
In order to identify novel proteins produced by activated macrophages, a cDNA library was made from cultures of the mouse macrophage-like cell line RAW 264.7 that had been treated with conditioned medium from mitogen-stimulated spleen cells, and the library was
Takanobu Utsumi et al.
The Journal of urology, 192(2), 567-574 (2014-02-13)
Renal cell carcinoma expresses CXCR3 but the function of CXCR3 in renal cell carcinoma has not been clarified. We explored the function of CXCR3 in renal cell carcinoma and investigated CXCR3 regulating factors. We obtained 56 clinical samples of clear cell

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.