This product is dialyzed in water before lyophilization and contains no buffers, salts or additives. The material is soluble in water at 1 mg/mL. For assay purposes, the product is reconstituted at 1 mg/mL in 0.85% NaCl.
C4874
Calmodulin bovine
recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE)
Sinonimo/i:
CaM, Phosphodiesterase 3:5-cyclic nucleotide activator, Phosphodiesterase 3′:5′-cyclic nucleotide activator
Autenticati per visualizzare i prezzi organizzativi e contrattuali.
Scegli un formato
Cambia visualizzazione
| Voi/SKU | Disponibilità | Prezzo |
|---|---|---|
0.2 mg | Per informazioni sulla disponibilità, contatta il Servizio Clienti. | 107,00 € |
0.5 mg | Per informazioni sulla disponibilità, contatta il Servizio Clienti. | 185,00 € |
1 mg | Per informazioni sulla disponibilità, contatta il Servizio Clienti. | 346,00 € |
2 mg | Per informazioni sulla disponibilità, contatta il Servizio Clienti. | 634,00 € |
Informazioni su questo articolo
Form:
lyophilized powder
Assay:
≥98% (SDS-PAGE)
Biological source:
bovine
Recombinant:
expressed in E. coli
Mol wt:
Mw 19000.9 by amino acid sequence
107,00 €
Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Servizio Tecnico
Hai bisogno di aiuto? Il nostro team di scienziati qualificati è a tua disposizione.
Permettici di aiutartibiological source
bovine
Quality Segment
recombinant
expressed in E. coli
assay
≥98% (SDS-PAGE)
form
lyophilized powder
mol wt
Mw 19000.9 by amino acid sequence
composition
Protein, ≥85%
UniProt accession no.
storage temp.
−20°C
Gene Information
bovine ... CALM(100297344)
General description
Sequence:
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
MGSSHHHHHHSSGLVPRGSHMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Calmodulin from bovine takes up a dumb-bell-structure. Two calcium binding EF hand loops, antiparallel β-sheet and three α-helices comprises a lobe. It has a central helix connecting the lobes. Calmodulin can bind four calcium molecules in a cooperative interaction pattern.
Application
Calmodulin bovine has been used inin vitro phosphorylation assay of recombinant retinoic acid-inducible gene I protein. It has also been used in the endoprotease Glu-C proteolysis and deamidation studies.
Biochem/physiol Actions
Ca2+ binding protein that is required for activation of cyclic nucleotide-dependent phosphodiesterase. It is also a cofactor/activator of nitric oxide synthase, calcineurin, and many kinases including ATPase, myosin light chain kinase, and CAM kinase I, II, and III. It mediates ryanodine receptor activation by cyclic ADP-ribose and is involved in intracellular Ca2+ homeostasis.
Calmodulin from bovine undergoes conformational changes upon calcium binding. It binds to sphingosylphosphorylcholine and inhibit calcineurin and phosphodiesterase enzymes.
Preparation Note
Produced using animal component-free materials.
1 of 1
Questo articolo | |||
|---|---|---|---|
| description recombinant, expressed in E. coli, lyophilized powder, ≥98% (SDS-PAGE) | description BioUltra, ≥98% (SDS-PAGE), lyophilized powder, essentially salt free | description lyophilized powder, 2,500-10,000 units/mg protein | description Calmodulin is a ubiquitous Ca2+-binding protein that serves as a physiological effector of a wide range of biological processes. Purified from bovine brain. |
| biological source bovine | biological source bovine testis | biological source bovine heart | biological source bovine brain |
| recombinant expressed in E. coli | recombinant - | recombinant - | recombinant - |
| assay ≥98% (SDS-PAGE) | assay ≥98% (SDS-PAGE) | assay - | assay ≥95% (SDS-PAGE) |
| mol wt Mw 19000.9 by amino acid sequence | mol wt 16.79 kDa | mol wt - | mol wt - |
| form lyophilized powder | form lyophilized powder | form lyophilized powder | form lyophilized |
| UniProt accession no. | UniProt accession no. | UniProt accession no. | UniProt accession no. - |
Classe di stoccaggio
11 - Combustible Solids
Che succede?
WGK 3
Punto di infiammabilità (°F)
Not applicable
Punto di infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
-
How was the protein lyophilized? What was the buffer, it's concentration and volume?
1 risposta-
Utile?
-