Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV49111

Sigma-Aldrich

Anti-C3ORF64 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-AER61, Anti-FLJ13078, Anti-FLJ33770, Anti-FLJ41219, Anti-MGC34132

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
374,00 €

374,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Tutte le immagini(1)

Scegli un formato

Cambia visualizzazione
100 μL
374,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

374,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

52 kDa

Reattività contro le specie

human, guinea pig, mouse, rat, horse, dog, rabbit, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_775925

N° accesso UniProt

Q5NDL2

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... C3orf64(285203)

Immunogeno

Synthetic peptide directed towards the C terminal region of human C3orf64

Applicazioni

Anti-C3ORF64 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

C3ORF64 is popular as EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase (EOGT; AOS4) is an O-GlcNAc transferase located in the endoplasmic reticulum. It catalyzes the addition of β-linked GlcNAc on Ser or Thr of EGF repeats. Mutations in EOGT gene reportedly result in genetic heterogeneity of Adams-Oliver Syndrome.

Sequenza

Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC20446

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Joshua F Alfaro et al.
Proceedings of the National Academy of Sciences of the United States of America, 109(19), 7280-7285 (2012-04-21)
O-linked N-acetylglucosamine (O-GlcNAc) is a reversible posttranslational modification of Ser and Thr residues on cytosolic and nuclear proteins of higher eukaryotes catalyzed by O-GlcNAc transferase (OGT). O-GlcNAc has recently been found on Notch1 extracellular domain catalyzed by EGF domain-specific OGT.
Ranad Shaheen et al.
American journal of human genetics, 92(4), 598-604 (2013-03-26)
Adams-Oliver syndrome (AOS) is a rare, autosomal-dominant or -recessive disorder characterized primarily by aplasia cutis congenita and terminal transverse limb defects. Recently, we demonstrated that homozygous mutations in DOCK6 cause an autosomal-recessive form of AOS. In this study, we sought
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.