AV48227

Anti-TCAP (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-CMD1N, Anti-LGMD2G, Anti-T-cap, Anti-TELE, Anti-Telethonin, Anti-Titin-cap (telethonin)
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 19 kDa
• Reattività contro le specie: human, mouse, rat, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_003664
• N° accesso UniProt: O15273
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TCAP(8557)

Descrizione

Descrizione generale

TCAP codes for a protein that binds to titin and acts as a substrate for titin kinase, thereby playing an important role in sarcomere assembly. Genetic mutations in Tcap have been linked to cardiomyopathies. Depletion of Tcap in zebrafish has been associated with muscular dystrophy.
Rabbit Anti-TCAP antibody recognizes human, mouse, rat, canine, bovine, and pig TCAP.

Immunogeno

Synthetic peptide directed towards the N terminal region of human TCAP

Applicazioni

Rabbit Anti-TCAP antibody is suitable for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. TCAP is a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in TCAP gene are associated with limb-girdle muscular dystrophy type 2G.Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibrils and other muscle related proteins are attached. This gene encodes a protein found in striated and cardiac muscle that binds to the titin Z1-Z2 domains and is a substrate of titin kinase, interactions thought to be critical to sarcomere assembly. Mutations in this gene are associated with limb-girdle muscular dystrophy type 2G. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequenza

Synthetic peptide located within the following region: CSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable