AV46276

Anti-ASF1B antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-ASF1 anti-silencing function 1 homolog B (S. cerevisiae), Anti-CIA-II, Anti-FLJ10604
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 22 kDa
• Reattività contro le specie: rat, guinea pig, mouse, human, bovine, dog
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_060624
• N° accesso UniProt: Q9NVP2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... ASF1B(55723)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human ASF1B

Applicazioni

Anti-ASF1B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.

Azioni biochim/fisiol

ASF1B [anti-silencing function 1 homolog B (S. cerevisiae)] gene encodes for a protein that belongs to H3/H4 family of histone chaperone proteins and facilitates the histone deposition as well as histone exchange and removal during nucleosome assembly and disassembly. ASF1B interacts with HCF-1 and regulates the progression of cellular DNA replication forks through chromatin reorganization. It also stimulates the viral DNA replication by combining Asf1b to DNA replication components. Additionally, depletion of both the histone chaperones ASF1a and ASF1b in human cells induces hallmark of alternative lengthening of telomeres (ALT) in primary as well as cancer cells.

Sequenza

Synthetic peptide located within the following region: YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable