Synthetic peptide directed towards the N terminal region of human PDE9A
Azioni biochim/fisiol
Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme. It belongs to an important protein family that catalyzes the hydrolysis of cyclic nucleotide monophosphates (cAMP and cGMP). The members of this family are also secondary intracellular messengers responsible for transducing a variety of extra-cellular signals.
Sequenza
Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
The Journal of pharmacology and experimental therapeutics, 341(2), 396-409 (2012-02-14)
Cyclic nucleotides are critical regulators of synaptic plasticity and participate in requisite signaling cascades implicated across multiple neurotransmitter systems. Phosphodiesterase 9A (PDE9A) is a high-affinity, cGMP-specific enzyme widely expressed in the rodent central nervous system. In the current study, we
Domande
Recensioni
★★★★★ Nessuna valutazione
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
