Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV44904

Sigma-Aldrich

Anti-FAM3C antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-Family with sequence similarity 3, member C, Anti-GS3786, Anti-ILEI

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
423,00 €

423,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
423,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

423,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

22 kDa

Reattività contro le specie

dog, rat, human, guinea pig, bovine

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... FAM3C(10447)

Immunogeno

Synthetic peptide directed towards the C terminal region of human FAM3C

Applicazioni

Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Azioni biochim/fisiol

FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.

Sequenza

Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

William S Streitfeld et al.
Cancer biology & therapy, 24(1), 2271638-2271638 (2023-11-06)
The poly(rC) binding protein 1 gene (PCBP1) encodes the heterogeneous nuclear ribonucleoprotein E1 (hnRNPE1), a nucleic acid-binding protein that plays a tumor-suppressive role in the mammary epithelium by regulating phenotypic plasticity and cell fate. Following the loss of PCBP1 function
Tatsuya Katahira et al.
Biochemical and biophysical research communications, 392(3), 301-306 (2010-01-12)
FAM3C is a secreted factor, which is involved in the epithelial to mesenchymal transition. In transcriptome profiling of the mouse retina using microarray, we found that FAM3C is highly expressed in the retina. FAM3C is expressed in the ganglion cell
Thomas Waerner et al.
Cancer cell, 10(3), 227-239 (2006-09-09)
Erk/MAPK and TGFbeta signaling cause epithelial to mesenchymal transition (EMT) and metastasis in mouse mammary epithelial cells (EpH4) transformed with oncogenic Ras (EpRas). In trials to unravel underlying mechanisms, expression profiling for EMT-specific genes identified a secreted interleukin-related protein (ILEI)

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.