Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV44138

Sigma-Aldrich

Anti-SLCO6A1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-GST, Anti-MGC26949, Anti-OATP6A1, Anti-OATPY, Anti-Solute carrier organic anion transporter family, member 6A1

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
325,00 €

325,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.
Tutte le immagini(1)

Scegli un formato

Cambia visualizzazione
100 μL
325,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

325,00 €

Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

79 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

NP_775759

N° accesso UniProt

Q86UG4

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... SLCO6A1(133482)

Categorie correlate

Immunogeno

Synthetic peptide directed towards the N terminal region of human SLCO6A1

Applicazioni

Anti-SLCO6A1 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Azioni biochim/fisiol

SLCO6A1 (GST) is an organic anion transporter expressed strongly in testis and weakly in brain (adult and fetal), placenta and spleen.[1] It is a putative cancer/testis (CT) cell surface antigen that might serve as a marker in medulloblastoma.[2]

Sequenza

Synthetic peptide located within the following region: CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC14524

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Sang-Yull Lee et al.
Cancer immunity, 4, 13-13 (2004-11-18)
Serological analysis of recombinant cDNA expression libraries (SEREX) has led to the identification of many of the antigens recognized by the immune system of cancer patients, which are collectively referred to as the cancer immunome. We used SEREX to screen
Sueli M Oba-Shinjo et al.
Cancer immunity, 8, 7-7 (2008-04-23)
Medulloblastoma is the most common childhood malignant tumor of the central nervous system. Treatment of medulloblastoma requires harmful therapy and nevertheless carries a poor prognosis. Due to their presence in various cancers and their limited expression in normal tissues, CT

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.