AV40257

Anti-RBMy1A1 antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-RBM1, Anti-RBM2, Anti-RBMY, Anti-RNA binding motif protein, Y-linked, family 1, member A1, Anti-YRRM1, Anti-YRRM2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 41 kDa
• Reattività contro le specie: human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001007527
• N° accesso UniProt: Q15414
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... RBMY1A1(5940)

Descrizione

Descrizione generale

RNA binding motif protein, γ-linked, family 1, member A1 (RBMy1A1, γRRM1, γRRM2) is a germ-cell specific nuclear RNA-binding protein involves in spermatogenesis. RBMγ binds to RNA stem-loops capped by a C(A)/(U)CAA pentaloops and participates in splicing within the testis by modulating the activity of constitutively expressed splicing factors.

Specificità

Anti-RBMy1A1 polyconal antibody reacts with chicken, human, mouse, rat, canine, and bovine RNA binding motif protein, γ-linked, family 1, member A1 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human RBMY1A1

Applicazioni

Anti-RBMy1A1 polyconal antibody is used to tag RNA binding motif protein, γ-linked, family 1, member A1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles RNA binding motif protein, γ-linked, family 1, member A1 in spermatogenesis.

Azioni biochim/fisiol

RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.

Sequenza

Synthetic peptide located within the following region: MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable