AV39473

Anti-LZTS1 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Leucine zipper, putative tumor suppressor 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 67 kDa
• Reattività contro le specie: horse, rat, guinea pig, mouse, bovine, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_066300
• N° accesso UniProt: Q9Y250
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... LZTS1(11178)

Descrizione

Descrizione generale

Leucine zipper, putative tumor suppressor 1 (LZTS1) is a protein that regulates the molecular events involved in progression of cells through the M phase of mitosis. It functions as a tumor suppressor for a range of major cancer histotypes, such as bladder cancer and urothelial carcinomas. LZTS1 is transiently expressed at the border of the ventricular and mantle zones in subsets of sensory and motor spinal neurons.

Specificità

Anti-LZTS1 polyclonal antibody reacts with human, mouse, rat, bovine, and canine leucine zipper, putative tumor suppressor 1 proteins.

Immunogeno

Synthetic peptide directed towards the C terminal region of human LZTS1

Applicazioni

Anti-LZTS1 polyclonal antibody is used to tag leucine zipper, putative tumor suppressor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine zipper, putative tumor suppressor 1 as a tumor suppressor gene and mediator of M-phase cell cycle progression.

Azioni biochim/fisiol

Leucine zipper putative tumor suppressor 1 (LZTS1) is a tumor suppressor gene involved in the cell growth activity.[1] It is down-regulated in several human malignancies. It retards the growth in cancer cells by regulating the mitotic process. It restricts Cdk1 (Cyclin-Dependent Kinase 1) activity by steadying the Cdc25C (cell division cycle 25C) phosphatase, a mitotic activator of Cdk1. Deregulation of this gene is associated with breast cancer and may serve as a prognostic factor for breast cancer therapy.[2][3] It is found to be down-regulated by promoter methylation.[4] This gene is found to be involved in ovarian carcinogenesis.[5]

Sequenza

Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable