Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV39390

Sigma-Aldrich

Anti-METTL3 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Methyltransferase like 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
325,00 €

325,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
325,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

325,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

64 kDa

Reattività contro le specie

mouse, rabbit, dog, rat, guinea pig, human, bovine, horse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... METTL3(56339)

Descrizione generale

Methyltransferase like 3 (METTL3 or M6A) codes for a 70 kDa subunit of MT-A. This protein forms a heterodimeric complex with METTL14 and subsequently modulates the methylation of the mammalian nuclear RNA, N6-adenosine.
Rabbit Anti-METTL3 antibody recognizes bovine, canine, human, mouse, rat, and zebrafish METTL3.

Immunogeno

Synthetic peptide directed towards the N terminal region of human METTL3

Applicazioni

Rabbit Anti-METTL3 antibody is suitable for use in western blot (5 μg/ml) and IHC (4-8 μg/ml) applications.

Azioni biochim/fisiol

METTL3 is the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Sequenza

Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 1

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Jianzhao Liu et al.
Nature chemical biology, 10(2), 93-95 (2013-12-10)
N(6)-methyladenosine (m(6)A) is the most prevalent and reversible internal modification in mammalian messenger and noncoding RNAs. We report here that human methyltransferase-like 14 (METTL14) catalyzes m(6)A RNA methylation. Together with METTL3, the only previously known m(6)A methyltransferase, these two proteins

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.