AV38284

Anti-TFAP2C antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-AP2γ, Anti-ERF1, Anti-TFAP2G, Anti-Transcription factor AP-2 γ (activating enhancer binding protein 2 γ), Anti-hAP-2g
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 49 kDa
• Reattività contro le specie: dog, mouse, human, pig, bovine, rabbit, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_003213
• N° accesso UniProt: Q92754
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TFAP2C(7022)

Descrizione

Descrizione generale

The AP2 family of transcription factors is expressed during mammalian development, morphogenesis and in various malignancies. Transcription factor AP-2 gamma (activating enhancer binding protein 2 gamma) (TFAP2G, AP2gamma, ERF1, TFAP2G, AP2-gamma) is a retinoic acid-responsive gene involved in placental development and the progression of human breast cancer. AP2-gamma is required for development and maintenance of extra-embryonic membranes, trophectoderm.

Specificità

Anti-TFAP2C polyclonal antibody reacts with human, mouse, rat, bovine, canine, zebrafish, pig, and chicken transcription factor AP-2 gamma proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human TFAP2C

Applicazioni

Anti-TFAP2C polyclonal antibody is used to tag transcription factor AP-2 gamma for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transcription factor AP-2 gamma in extra-embryonic membrane development during embryo gestation.

Azioni biochim/fisiol

TFAP2C is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.The protein encoded by this gene is a sequence-specific DNA-binding transcription factor involved in the activation of several developmental genes. The encoded protein can act as either a homodimer or heterodimer with other family members and is induced during retinoic acid-mediated differentiation. It plays a role in the development of the eyes, face, body wall, limbs, and neural tube.

Sequenza

Synthetic peptide located within the following region: MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable