Passa al contenuto
Merck
Tutte le immagini(2)

Documenti

AV35242

Sigma-Aldrich

Anti-TRPM5 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-LTRPC5, Anti-MTR1, Anti-Transient receptor potential cation channel, subfamily M, member 5

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

131 kDa

Reattività contro le specie

mouse, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... TRPM5(29850)

Descrizione generale

TRPM5 is a Ca+-activated channel that is involved in the transduction of umami, sweet and bitter tastes. Voltage, temperature, acidic pH and phosphoinositides are known to modulate TRPM5 function. It regulates mucin secretion in colon and pheromone transduction in olfactory epithelia. TRPM5 has been studied as a target for obesity treatment.
Rabbit Anti-TRPM5 antibody recognizes human, canine, and mouse TRPM5.

Immunogeno

Synthetic peptide directed towards the N terminal region of human TRPM5

Applicazioni

Rabbit Anti-TRPM5 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.

Azioni biochim/fisiol

TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

Sequenza

Synthetic peptide located within the following region: EKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Fabián López et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(9), 3268-3278 (2014-02-28)
Growing evidence suggests that the main olfactory epithelium contains a subset of olfactory sensory neurons (OSNs) responding to pheromones. One candidate subpopulation expresses the calcium activated cation channel TRPM5 (transient receptor potential channel M5). Using GFP driven by the TRPM5
R Kyle Palmer et al.
Current topics in medicinal chemistry, 13(3), 247-257 (2013-02-26)
The disease of obesity is one of the greatest healthcare challenges of our time. The increasing urgency for effective treatment is driving an intensive search for new targets for anti-obesity drug discovery. The TRP channel super family represents a class
Yi-Hong Li et al.
eLife, 12 (2024-06-05)
Tuft cells are a group of rare epithelial cells that can detect pathogenic microbes and parasites. Many of these cells express signaling proteins initially found in taste buds. It is, however, not well understood how these taste signaling proteins contribute
E R Liman
Handbook of experimental pharmacology, (179)(179), 287-298 (2007-01-16)
TRPM5 is a cation channel that it is essential for transduction of bitter, sweet and umami tastes. Signaling of these tastes involves the activation of G protein-coupled receptors that stimulate phospholipase C (PLC) beta2, leading to the breakdown of phosphatidylinositol
Sandra Mitrovic et al.
eLife, 2, e00658-e00658 (2013-06-07)
Mucin 5AC (MUC5AC) is secreted by goblet cells of the respiratory tract and, surprisingly, also expressed de novo in mucus secreting cancer lines. siRNA-mediated knockdown of 7343 human gene products in a human colonic cancer goblet cell line (HT29-18N2) revealed

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.