CBX8 is a polycomb group protein that associates with other proteins such as TIP60 and MLL-AF9. CBX8 also forms a part of the PRC1 complexes. It regulates fibroblast proliferation and cell survival. Furthermore, studies have reported that CBX8 is needed for MLL-AF9-induced transcription and leukemogenesis. Rabbit Anti-CBX8 (AB1) antibody recognizes bovine, human, mouse, rat, and canine CBX8.
Immunogeno
Synthetic peptide directed towards the middle region of human CBX8
Applicazioni
Rabbit Anti-CBX8 (AB1) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.
Azioni biochim/fisiol
CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.
Sequenza
Synthetic peptide located within the following region: QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGALDPNGTRVRH
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Chromosomal translocations involving the mixed lineage leukemia (MLL) gene lead to the development of acute leukemias. Constitutive HOX gene activation by MLL fusion proteins is required for MLL-mediated leukemogenesis; however, the underlying mechanisms remain elusive. Here, we show that chromobox
The Polycomb group (PcG) proteins are essential for embryogenesis, and their expression is often found deregulated in human cancer. The PcGs form two major protein complexes, called polycomb repressive complexes 1 and 2 (PRC1 and PRC2) whose function is to
Domande
Recensioni
★★★★★ Nessuna valutazione
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
