Passa al contenuto
Merck
Tutte le immagini(5)

Documenti

AV32537

Sigma-Aldrich

Anti-POU2F3 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-POU domain, class 2, transcription factor 3

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(5)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Forma fisica

buffered aqueous solution

PM

47 kDa

Reattività contro le specie

guinea pig, dog, rabbit, human, rat, sheep, mouse

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_055167

N° accesso UniProt

Q9UKI9

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... POU2F3(25833)

Categorie correlate

Descrizione generale

POU2F3, also known as Skn-1a and OCT11, gene is mapped to human chromosome 11q23.3. The gene codes for a keratinocyte-specific POU transcription factor. The protein is expressed in stratified squamous epithelia, including the epidermis, cervix and foreskin.

Immunogeno

Synthetic peptide directed towards the N terminal region of human POU2F3

Applicazioni

Rabbit Anti-POU2F3 antibody can be used for western blotting applications at a concentration of 0.5μg/ml. It can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Azioni biochim/fisiol

POU2F3 is a transcription factor that is involved in the growth and differentiation of keratinocytes. Studies have reported that Pou2f3 (Skn-1a) is involved in the differentiation of chemosensory cells. Furthermore, this transcription factor is also required for specifying the lineage of taste receptor cells.

Sequenza

Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Certificati d'analisi (COA)

Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Monika I Hollenhorst et al.
Respiratory research, 24(1), 267-267 (2023-11-05)
Airway tuft cells, formerly called brush cells have long been described only morphologically in human airways. More recent RNAseq studies described a chemosensory cell population, which includes tuft cells, by a distinct gene transcription signature. Yet, until which level in
Makoto Ohmoto et al.
Bioscience, biotechnology, and biochemistry, 77(10), 2154-2156 (2013-10-08)
Solitary chemosensory cells in the non-neuronal epithelium of the anterior nasal cavity have bitter taste cell-like molecular characteristics and are involved in the detection of noxious substances. Here, we demonstrate that Pou2f3/Skn-1a, which is necessary for generation of sweet, umami
Ichiro Matsumoto et al.
Nature neuroscience, 14(6), 685-687 (2011-05-17)
Functional diversification of taste cells is crucial for proper discrimination of taste qualities. We found the homeodomain protein Skn-1a (Pou2f3) to be expressed in sweet, umami and bitter taste cells. Skn-1a-deficient mice lacked electrophysiological and behavioral responses to sweet, umami
Z Zhang et al.
Oncogene, 25(39), 5436-5445 (2006-04-12)
POU2F3 (OCT11, Skn-1a) is a keratinocyte-specific POU transcription factor whose expression is tied to squamous epithelial stratification. It is also a candidate tumor suppressor gene in cervical cancer (CC) because it lies in a critical loss of heterozygosity region on

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.