AV32519
Anti-FOSB antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-FBJ murine osteosarcoma viral oncogene homolog B
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
36 kDa
Reattività contro le specie
human, horse, bovine
Concentrazione
0.5 mg - 1 mg/mL
tecniche
immunohistochemistry: suitable
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... FOSB(2354)
Descrizione generale
FOSB is a leucine zipper protein that functions as a transcriptional regulator. Studies in mice have reported that FOSB is involved in cocaine-induced behavioral responses.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Rabbit Anti-FOSB antibody recognizes human, mouse, rat, bovine, and canine FOSB.
Immunogeno
Synthetic peptide directed towards the C terminal region of human FOSB
Applicazioni
Rabbit Anti-FOSB antibody can be used for IHC (4-8μg/ml) and western blot (1.25μg/ml) applications.
Azioni biochim/fisiol
The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. They are leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation.
Sequenza
Synthetic peptide located within the following region: DLPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVL
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
R F De Pauli et al.
Pharmacology, biochemistry, and behavior, 117, 70-78 (2013-12-21)
Chronic drug exposure and drug withdrawal induce expressive neuronal plasticity which could be considered as both functional and pathological responses. It is well established that neuronal plasticity in the limbic system plays a pivotal role in relapse as well as
N Hiroi et al.
Proceedings of the National Academy of Sciences of the United States of America, 94(19), 10397-10402 (1997-09-18)
Chronic exposure to cocaine leads to prominent, long-lasting changes in behavior that characterize a state of addiction. The striatum, including the nucleus accumbens and caudoputamen, is an important substrate for these actions. We previously have shown that long-lasting Fos-related proteins
Izabelle Dias Benfato et al.
Behavioural brain research, 417, 113630-113630 (2021-10-18)
Social isolation gained discussion momentum due to the COVID-19 pandemic. Whereas many studies address the effects of long-term social isolation in post-weaning and adolescence and for periods ranging from 4 to 12 weeks, little is known about the repercussions of
Josy Carolina C Pontes et al.
Epilepsy research, 126, 16-25 (2016-07-16)
The efficiency of most of the new antiepileptic drugs (AEDs) on clinical trials still falls short the success reported in pre-clinical studies, possibly because the validity of the animal models is insufficient to fully represent the human pathology. To improve
M C Gruda et al.
Oncogene, 12(10), 2177-2185 (1996-05-16)
FosB, one of the members of the Fos family, is rapidly induced in many cell types upon stimulation and has a stimulatory effect on the proliferation of cultured cells. To understand the tissue distribution of FosB, we have studied its
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.