Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

AV31839

Sigma-Aldrich

Anti-PTF1A antibody produced in rabbit

IgG fraction of antiserum

Sinonimo/i:

Anti-Pancreas specific transcription factor, 1a

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
325,00 €

325,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
325,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

325,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

IgG fraction of antiserum

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

35 kDa

Reattività contro le specie

human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... PTF1A(256297)

Descrizione generale

PTF1A is a part of the pancreas transcription factor 1 complex that regulates the expression of exocrine pancreas-specific genes. Ptf1a is required for GABAergic neuronal cell fates during spinal cord development. Furthermore, Ptf1a provides a link between the development of inhibitory and excitatory interneurons. Mutations in PTF1A have been associated with diabetes mellitus and cerebellar agenesis.
Rabbit Anti-PTF1A antibody recognizes canine, human, mouse, rat, and zebrafish PTF1A.

Immunogeno

Synthetic peptide directed towards the N terminal region of human PTF1A

Applicazioni

Rabbit Anti-PTF1A antibody can be used for western blot application at a concentration of 2.5μg/ml.

Azioni biochim/fisiol

PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.

Sequenza

Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Stacey M Glasgow et al.
Development (Cambridge, England), 132(24), 5461-5469 (2005-11-18)
Mutations in the human and mouse PTF1A/Ptf1a genes result in permanent diabetes mellitus and cerebellar agenesis. We show that Ptf1a is present in precursors to GABAergic neurons in spinal cord dorsal horn as well as the cerebellum. A null mutation

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.