Passa al contenuto
Merck
Tutte le immagini(2)

Documenti fondamentali

AV31658

Sigma-Aldrich

Anti-ETV5 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-ERM, Anti-Ets variant gene 5 (Ets-related molecule)

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali

Scegli un formato

100 μL
374,00 €

374,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.


Scegli un formato

Cambia visualizzazione
100 μL
374,00 €

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

374,00 €


Per informazioni sulla disponibilità, contatta il Servizio Clienti.

Origine biologica

rabbit

Livello qualitativo

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

58 kDa

Reattività contro le specie

horse, dog, guinea pig, human, rabbit, bovine, rat

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... ETV5(2119)

Descrizione generale

ETV5 is a transcription factor that regulates the self-renewal of spermatogonial stem cells (SSCs). ETV5 loss has been linked to SSC loss and infertility.
Rabbit Anti-ETV5 (AB2) antibody recognizes human, mouse, bovine, zebrafish, canine, and rat ETV5.

Immunogeno

Synthetic peptide directed towards the N terminal region of human ETV5

Applicazioni

Rabbit Anti-ETV5 (AB2) antibody can be used for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer.

Sequenza

Synthetic peptide located within the following region: MDGFYDQQVPFMVPGKSRSEECRGRPVIDRKRKFLDTDLAHDSEELFQDL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Heather N Schlesser et al.
Biology of reproduction, 78(3), 483-489 (2007-11-23)
The transcription factor ets variant gene 5 (ETV5; also known as ERM) is essential for self-renewal of spermatogonial stem cells (SSCs). Mice with targeted disruption of Etv5 (Etv5(-/-)) undergo the first wave of spermatogenesis, but all SSCs are lost during

Domande

Recensioni

Nessuna valutazione

Filtri attivi

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.