Synthetic peptide directed towards the C terminal region of human RNASEL
Applicazioni
Anti-RNASEL antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Azioni biochim/fisiol
Endoribonuclease L (RNaseL) is an enzyme activated by its allosteric activator 2′,5′-linked oligoadenylates (2-5A). The 2-5A/RNaseL system is induced by interferons and cleaves single-stranded RNA molecules in U-rich sequences. This pathway mediates immunomodulatory, antiviral and antiproliferative effects.
Sequenza
Synthetic peptide located within the following region: MKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGA
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research, 31(1), 49-57 (2010-12-31)
The interferon (IFN)-inducible 2'-5'-oligoadenylate synthetase (OAS)/RNase L pathway blocks infections by some types of viruses through cleavage of viral and cellular single-stranded RNA. Viruses induce type I IFNs that initiate signaling to the OAS genes. OAS proteins are pathogen recognition
Frontiers in bioscience (Scholar edition), 4, 767-786 (2011-12-29)
The endoribonuclease RNase-L is the terminal component of an RNA cleavage pathway that mediates antiviral, antiproliferative and immunomodulatory activities. Inactivation or dysregulation of RNase-L is associated with a compromised immune response and increased risk of cancer, accordingly its activity is
The endoribonuclease L (RNase L) is the effector of the 2-5A system, a major enzymatic pathway involved in the molecular mechanism of interferons (IFNs). RNase L is a very unusual nuclease with a complex mechanism of regulation. It is a
Domande
Recensioni
★★★★★ Nessuna valutazione
Filtri attivi
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
