AV03042

Anti-RBX1 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Ring-box 1
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Stato: buffered aqueous solution
• PM: 12 kDa
• Reattività contro le specie: mouse, rat, bovine, guinea pig, dog, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_055063
• N° accesso UniProt: P62877
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... RBX1(9978)

Descrizione

Immunogeno

Synthetic peptide directed towards the middle region of human RBX1

Applicazioni

Anti-RBX1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Azioni biochim/fisiol

RBX1 is a component of SCF E3 ubiquitin ligase and participates in tagging and degradation of various substrates in the cell to maintain homeostasis. It is crucial in meiotic maturation process of mouse oocytes.[1] RBX1 is essential maintaining the integrity of genome and for development and viability in C. elegans.

Sequenza

Synthetic peptide located within the following region: NQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable