AV00022

Anti-CFLAR antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-CASP8 and FADD-like apoptosis Regulator
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 55 kDa
• Reattività contro le specie: human, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_003870
• N° accesso UniProt: O15519
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... CFLAR(8837)

Descrizione

Descrizione generale

CFLAR is a regulator of apoptosis that is thought to be cleaved by caspase-8. Rabbit Anti-CFLAR antibody recognizes canine, human, mouse, rat, bovine, and pig CFLAR.

Immunogeno

Synthetic peptide directed towards the N terminal region of human CFLAR

Applicazioni

Rabbit Anti-CFLAR antibody can be used for western blot assays at 1.25μg/ml.

Sequenza

Synthetic peptide located within the following region: HQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLA

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable