06-596
Anti-STAT3 Antibody
Upstate®, from rabbit
Sinonimo/i:
Acute-phase response factor, DNA-binding protein APRF, signal transducer and activator of transcription, signal transducer and activator of transcription, (acute-phase response factor)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
eCl@ss:
32160702
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Forma dell’anticorpo
purified immunoglobulin
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Reattività contro le specie
mouse, human, rat
Produttore/marchio commerciale
Upstate®
tecniche
ChIP: suitable
electrophoretic mobility shift assay: suitable
immunocytochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable
Isotipo
IgG
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... STAT3(6774)
mouse ... Stat3(20848)
Descrizione generale
STAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.
Specificità
Recognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.
Immunogeno
Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Epitope: a.a. 688-722
Applicazioni
Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
Immunoprecipitation:
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Research Category
Epigenetics & Nuclear Function
Epigenetics & Nuclear Function
Research Sub Category
Transcription Factors
Transcription Factors
Qualità
Routinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
Descrizione del bersaglio
92 kDa
Linkage
Replaces: 04-1014
Stato fisico
Format: Purified
Protein A purified
Protein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.
Stoccaggio e stabilità
Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.
Risultati analitici
Control
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.
Altre note
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Note legali
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our Motore di ricerca dei prodotti.
Raccomandato
N° Catalogo
Descrizione
Determinazione del prezzo
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 1
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
The box-1 region of the leukemia inhibitory factor receptor alpha-chain cytoplasmic domain is sufficient for hemopoietic cell proliferation and differentiation
Zhang, Y., et al
The Journal of Biological Chemistry, 273, 34370-34383 (1998)
Differentiation of oligodendroglial progenitors derived from cortical multipotent cells requires extrinsic signals including activation of gp130/LIFbeta receptors
Marmur, R., et al
The Journal of Neuroscience, 18, 9800-9811 (1998)
M Ernst et al.
The Journal of biological chemistry, 274(14), 9729-9737 (1999-03-27)
Cell type-specific responses to the leukemia inhibitory factor (LIF)/interleukin 6 cytokine family are mediated by dimerization of the LIF receptor alpha-chain (LIFRalpha) with the signal transducer gp130 or of two gp130 molecules followed by activation of the JAK/STAT and Ras/mitogen-activated
Nuclear expression of a group II intron is consistent with spliceosomal intron ancestry.
Chalamcharla VR, Curcio MJ, Belfort M
Genes & Development null
Asher Shushan et al.
Human reproduction (Oxford, England), 19(9), 1957-1967 (2004-06-19)
Uterine leiomyomas are the most common benign smooth muscle cell tumours in women. Formation of leiomyomas, still not completely understood, is viewed as a multistep process, with involvement of ovarian steroid hormones, cytokines and growth factors. Our study aimed to
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.