Skip to Content
Merck
All Photos(3)

Key Documents

HPA024802

Sigma-Aldrich

Anti-SLC19A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-FOLT, Anti-solute carrier family 19 (folate transporter), member 1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
HUF 220,000.00

HUF 220,000.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
HUF 220,000.00

About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

HUF 220,000.00


Please contact Customer Service for Availability

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SLC19A1(6573)

General description

The gene SLC19A1 (solute carrier family 19 member 1) is mapped to human chromosome 21q22. It is expressed in many tissues, mainly enterocytes and hepatocytes.

Immunogen

solute carrier family 19 (folate transporter), member 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-SLC19A1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

At physiological pH, SLC19A1 (solute carrier family 19 member 1) is involved in the transfer of reduced folates into the cells. It is also involved in the uptake of the antifolate methotrexate. In osteosarcoma and neuroblastoma, decrease in the activity of SLC19A1 leads to methotrexate resistance.[1] In patients with colorectal cancer, high expression of SLC19A1 reduces risk of recurrent disease (disease-free survival). SLC19A1 might be linked with non-syndromic cleft lip and palate and neural tube defects. Additionally, mutations in SLC19A1 gene are associated with risk of ischemic stroke.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73240

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

H L Hébert et al.
The British journal of dermatology, 166(3), 474-482 (2011-11-05)
The era of genome-wide association studies has revolutionized the search for genetic susceptibility loci in complex genetic conditions such as psoriasis. There are currently 16 loci with confirmed evidence for association with psoriasis susceptibility but there is the potential for
Elixabet Lopez-Lopez et al.
The Journal of clinical investigation, 130(12), 6600-6615 (2020-11-10)
BACKGROUNDInterpatient differences in the accumulation of methotrexate's active polyglutamylated metabolites (MTXPGs) in leukemia cells influence its antileukemic effects.METHODSTo identify genomic and epigenomic and patient variables determining the intracellular accumulation of MTXPGs, we measured intracellular MTXPG levels in acute lymphoblastic leukemia
Adipocyte expression of SLC19A1 links DNA hypermethylation to adipose tissue inflammation and insulin resistance
Petrus P, et al.
The Journal of Clinical Endocrinology and Metabolism, 103(2), 710-721 (2017)
Bhaskar Lakkakula et al.
The journal of maternal-fetal & neonatal medicine : the official journal of the European Association of Perinatal Medicine, the Federation of Asia and Oceania Perinatal Societies, the International Society of Perinatal Obstetricians, 28(3), 329-332 (2014-04-23)
Folate metabolism involves absorption, transport, modifications and interconversions of folates. The reduced folate carrier does not participate directly in folate metabolism but plays a major role in intracellular transport of metabolically active 5-methyltetrahydrofolate and maintains the intracellular concentrations of folate.
Diana T Lau et al.
Oncotarget, 6(17), 15510-15523 (2015-04-11)
MYCN amplification occurs in 20% of neuroblastomas and is strongly related to poor clinical outcome. We have identified folate-mediated one-carbon metabolism as highly upregulated in neuroblastoma tumors with MYCN amplification and have validated this finding experimentally by showing that MYCN

Questions

Reviews

No rating value

Active Filters

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service