Skip to Content
Merck
All Photos(1)

Key Documents

AV50821

Sigma-Aldrich

Anti-LIN9 (AB2) antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BARA, Anti-BARPsv, Anti-Lin-9, Anti-Lin-9 homolog (C. elegans), Anti-TGS, Anti-TGS1

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
HUF 149,300.00

HUF 149,300.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
HUF 149,300.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

HUF 149,300.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

53 kDa

species reactivity

guinea pig, horse, mouse, bovine, dog, human, rat, rabbit

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... LIN9(286826)

Immunogen

Synthetic peptide directed towards the N terminal region of human LIN9

Application

Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

Lin-9 homolog (C. elegans) is a tumor suppressor that associates with retinoblastoma 1 protein and inhibits DNA synthesis and regulates cell cycle and cell cycle-dependent gene expression.[1] LIN9 is a subunit of DREAM complex and regulates gene expression and proliferation of embryonic stem cells.[2]

Sequence

Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jasmina Esterlechner et al.
PloS one, 8(5), e62882-e62882 (2013-05-15)
The DREAM complex plays an important role in regulation of gene expression during the cell cycle. We have previously shown that the DREAM subunit LIN9 is required for early embryonic development and for the maintenance of the inner cell mass
Nina Reichert et al.
Molecular and cellular biology, 30(12), 2896-2908 (2010-04-21)
The retinoblastoma tumor suppressor protein (pRB) and related p107 and p130 "pocket proteins" function together with the E2F transcription factors to repress gene expression during the cell cycle and development. Recent biochemical studies have identified the multisubunit DREAM pocket protein

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service