Skip to Content
Merck
All Photos(2)

Key Documents

AV35178

Sigma-Aldrich

Anti-KCNA10 antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-Potassium voltage-gated channel, shaker-related subfamily, member 10

Sign Into View Organizational & Contract Pricing

Select a Size

100 μL
HUF 131,000.00

HUF 131,000.00


Please contact Customer Service for Availability


Select a Size

Change View
100 μL
HUF 131,000.00

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

HUF 131,000.00


Please contact Customer Service for Availability

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

56 kDa

species reactivity

human, rat, mouse, bovine

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... KCNA10(3744)

General description

KCNA10 codes for a tetrameric protein that belongs to the potassium channel, voltage-gated (shaker-related) family. It is strongly expressed in hair cells of the inner ear in mice[1]. A null mutation in Kcna10 has been linked to vestibular and hearing dysfunctions in mice[2].
Rabbit Anti-KCNA10 antibody recognizes human, mouse, rat, and chicken KCNA10.

Immunogen

Synthetic peptide directed towards the middle region of human KCNA10

Application

Rabbit Anti-KCNA10 antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications.

Biochem/physiol Actions

Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

Sequence

Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sue I Lee et al.
Hearing research, 300, 1-9 (2013-03-27)
KCNA10 is a voltage gated potassium channel that is expressed in the inner ear. The localization and function of KCNA10 was studied in a mutant mouse, B6-Kcna10(TM45), in which the single protein coding exon of Kcna10 was replaced with a
Francesca A Carlisle et al.
Gene expression patterns : GEP, 12(5-6), 172-179 (2012-03-27)
The development of the organ of Corti and the highly specialized cells required for hearing involves a multitude of genes, many of which remain unknown. Here we describe the expression pattern of three genes not previously studied in the inner

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service