AV34357

Anti-C14ORF101 antibody produced in rabbit

affinity isolated antibody

• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 79 kDa
• species reactivity: human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_060269
• UniProt accession no.: Q9NX78
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... C14ORF101(54916)

Description

General description

C14ORF101 (TMEM260) is a transmembrane protein.
Rabbit Anti-C14ORF101 antibody recognizes human, mouse, rat, and bovine C14ORF101.

Immunogen

Synthetic peptide directed towards the N terminal region of human C14ORF101

Application

Rabbit Anti-C14ORF101 antibody can be used for western blot applications at a concentration of 0.125 μg/ml.

Biochem/physiol Actions

C14orf101 is a protein predicted based on an ORF found in chromosome 14.

Sequence

Synthetic peptide located within the following region: WGDQTTLQGFLTHFLREEYGTFSLAKSEIGSSMSEILLSQVTNMRTELSF

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable